PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa018426
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family Dof
Protein Properties Length: 219aa    MW: 24786.2 Da    PI: 8.2205
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-187a-Lactuca_sativa-27641PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof121.52.8e-3847104663
     zf-Dof   6 lkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63 
                l+cprC+s+ntkfCyynnysl+qPry+CkaCrryWt+GG+lrnvPvGgg+rknk+sss
  Lsa018426  47 LNCPRCKSSNTKFCYYNNYSLTQPRYLCKACRRYWTQGGSLRNVPVGGGSRKNKRSSS 104
                79****************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027014.8E-3347101IPR003851Zinc finger, Dof-type
ProDomPD0074783.0E-194792IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.6447101IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104985IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 219 aa     Download sequence    Send to blast
MDASQWKLEA VNNNNNNNNI DQVEERKVRP QEQEQEQGQA QPAGGPLNCP RCKSSNTKFC  60
YYNNYSLTQP RYLCKACRRY WTQGGSLRNV PVGGGSRKNK RSSSSSITTD QDTQHLNLSF  120
QVQQPDYHHN HNHNHGFSQF LKLPKVENSS NQLINPFGSN SNPVFNVQVD EINGGFQEIL  180
LPFGVMMNQQ HLSSTRTIRE GDAQNMGSTG YWTSTFLGD
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006603757.11e-42PREDICTED: dof18 isoform X1
RefseqXP_006603758.11e-42PREDICTED: dof18 isoform X1
RefseqXP_006603759.11e-42PREDICTED: dof18 isoform X1
RefseqXP_006603760.11e-42PREDICTED: dof18 isoform X1
RefseqXP_006603761.11e-42PREDICTED: dof18 isoform X1
TrEMBLA0A124SAZ03e-53A0A124SAZ0_CYNCS; Zinc finger, Dof-type
STRINGGLYMA19G44670.34e-42(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61850.44e-30Dof family protein